PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00004603-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family BBR-BPC
Protein Properties Length: 339aa    MW: 37334.2 Da    PI: 9.7583
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00004603-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind275.72.3e-8413091293
              GAGA_bind   1 mdddgsre.rnkgyyepa.aslkenlglqlmssiaerdaki..................rernlalsekkaavaerd.....maflqr 63 
                            md +g+++ rn+g+ ep  +s+k++lglql++s+ae+                      + + +  s + ++++++      +++   
  SMil_00004603-RA_Salv   1 MDGNGNMNfRNWGFLEPPaSSMKNQLGLQLITSMAEKPLFGgggggggggggfrdhqhlHPSPVMSSINGGPFHHHRvggisESHIPV 88 
                            999*************8889**************9877665999*******9975544433444233333444555479999899999 PP

              GAGA_bind  64 dkalaernkalverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkk 151
                            d ++++        ++k+l++l+v+++ a  + ++++v+++++s++s+q+ ++ +l++    ++e+e++ +++     ++   +  kk
  SMil_00004603-RA_Salv  89 DYWMNQ-------SREKYLNVLPVNHQPAYYQ-SSYGVSPESSSAHSVQMPQQFNLQKAENVMSEMEEMCEEKDDGGCSSGGAVVVKK 168
                            ******.......7889******999866555.7899*************88877777666667776666655555555666666666 PP

              GAGA_bind 152 krqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCttti 239
                            ++ ++ ++ ++k+kk++ +++ + +++ ++ + +r++ +kk  ++v+ng+++D+s +P+PvCsCtGa++qCY+WG+GGWqSaCCtt +
  SMil_00004603-RA_Salv 169 RGGSKVTNSTPKEKKPRTRTPRPPRDEPTPPS-SRARIPKKRAEIVINGINMDISEIPIPVCSCTGAPQQCYRWGSGGWQSACCTTHM 255
                            66666777778888888888888777777764.79***************************************************** PP

              GAGA_bind 240 SvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHG 293
                            S yPLP s krrgaRiagrKmS gafkk+LekLa+eGy++s p+DL++hWAkH 
  SMil_00004603-RA_Salv 256 SEYPLPPSDKRRGARIAGRKMSIGAFKKVLEKLASEGYNFSSPIDLRSHWAKHA 309
                            *****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062175.1E-881309IPR010409GAGA-binding transcriptional activator
SMARTSM012262.0E-1041308IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDGNGNMNFR NWGFLEPPAS SMKNQLGLQL ITSMAEKPLF GGGGGGGGGG GGFRDHQHLH  60
PSPVMSSING GPFHHHRVGG ISESHIPVDY WMNQSREKYL NVLPVNHQPA YYQSSYGVSP  120
ESSSAHSVQM PQQFNLQKAE NVMSEMEEMC EEKDDGGCSS GGAVVVKKRG GSKVTNSTPK  180
EKKPRTRTPR PPRDEPTPPS SRARIPKKRA EIVINGINMD ISEIPIPVCS CTGAPQQCYR  240
WGSGGWQSAC CTTHMSEYPL PPSDKRRGAR IAGRKMSIGA FKKVLEKLAS EGYNFSSPID  300
LRSHWAKHAW RFWVVTNYSA SRIELHFPEF LPPGARGRF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083223.11e-163PREDICTED: protein BASIC PENTACYSTEINE2-like
TrEMBLH1ZN721e-123H1ZN72_TRIPD; GAGA-binding transcriptional activator
STRINGPGSC0003DMT4000693031e-102(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA100482026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.33e-73basic pentacysteine 2